You can buy experimental Laser system for experiments in Wave Genetics and Torsion fields. Creation on their basis of individual meditative musical programs. We also translate into the melody the sequenced sections of genes, thereby producing Music of DNA.
Dna Music – How the Human GJB2 Gene Sings (translation mRNA)—————————–Translation into a melody from amino acid assembly sequences.The melody of the translation (assembly) of amino acids (proteins) from the mRNA template region of the human GJB2 gene—————————–Homo sapiens gap junction protein beta 2 (GJB2), mRNA/ gene = ”GJB2 ″/ Translation = “MDWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVW GDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEK KRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDG …
Transfer to the melody of the amino acid assembly sequence of the sequencing protein telomerase reverse transcriptase isoform 2 [Homo sapiens]
Transfer to the melody of the amino acid assembly sequence of the sequencing protein TSPO transcript
Transfer to the melody of the amino acid assembly sequence of the basic myelin protein.A melody of translation (assembly) of amino acids (proteins) from the mRNA template region of the human MBP gene———————–
Translation on the assembly notes in the ribosome of proteins from the matrix mRNA of the Barley cultivar OWB-D (R gene), partial cds
Translation on the assembly notes in the ribosome of proteins from the matrix mRNA of the Indigofera cytisoides source https://www.ncbi.nlm.nih.gov/protein/AJP09288.1
Translation on the assembly notes in the ribosome of proteins from the matrix mRNA of the Homo sapiens proteoglycan 2 gene, pro eosinophil major basic protein (PRG2), transcript variant 2, mRNAA sourcehttps://www.ncbi.nlm.nih.gov/nuccore/NM_001243245