You can buy experimental Laser system for experiments in Wave Genetics and Torsion fields. Creation on their basis of individual meditative musical programs. We also translate into the melody the sequenced sections of genes, thereby producing Music of DNA.

Music Genome Covid-19 Delta variant

This is a translation into the music of the genomic code Covid-19 type Delta.Each note in track is presented translation of the codon RNA gene Covid-19.Each track is sold separately and offers in a single copy NFT.You can become the only one in world collector of this album.

Music Genome Covid-19

This is a translation into the music of the genomic code Covid-19 type Wuhan-Hu-1.Each note in track is presented translation of the codon RNA gene Covid-19 type Wuhan-Hu-1. The album contains 11 music tracks, 11 participants virus genes. You can become the only one in world collector of this album. — The uniqueness of the …

DNA music – aquaporin 4 Homo sapiens

How does the assembly in the ribosome from the messenger mRNA of a gene region sound if translated into notes and sounded with various instruments. You are listening to the melody of the protein sequence assemblyFrom the human GENE AQP4Human AQP4 gene: identification of a locus encoding two polypeptide water channels in the brain.

DNA Music – Homo sapiens myelin basic protein (MBP), transcript variant 1, translation

Transfer to the melody of the amino acid assembly sequence of the basic myelin protein.A melody of translation (assembly) of amino acids (proteins) from the mRNA template region of the human MBP gene———————–

DNA Music – sequencing protein TSPO transcript

Transfer to the melody of the amino acid assembly sequence of the sequencing protein TSPO transcript.You are listening to the melody of the protein sequence assemblyFrom the human TSPO GENE Homo sapiens translocator protein (18kDa) (TSPO), transcript variant PBR-S, mRNA

Dna Music – How the Human GJB2 Gene Sings (translation mRNA)

Dna Music – How the Human GJB2 Gene Sings (translation mRNA)—————————–Translation into a melody from amino acid assembly sequences.The melody of the translation (assembly) of amino acids (proteins) from the mRNA template region of the human GJB2 gene—————————–Homo sapiens gap junction protein beta 2 (GJB2), mRNA/ gene = ”GJB2 ″/ Translation = “MDWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVW GDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEK KRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDG …

DNA Music – sequencing protein telomerase reverse transcriptase isoform 2 [Homo sapiens]

Transfer to the melody of the amino acid assembly sequence of the sequencing protein telomerase reverse transcriptase isoform 2 [Homo sapiens]

Genome Music – Barley cultivar OWB-D (R gene), partial cds

Translation on the assembly notes in the ribosome of proteins from the matrix mRNA of the Barley cultivar OWB-D (R gene), partial cds

Genome music (chloroplast) Indigofera cytisoides

Translation on the assembly notes in the ribosome of proteins from the matrix mRNA of the Indigofera cytisoides source