You can buy experimental Laser system for experiments in Wave Genetics and Torsion fields. Creation on their basis of individual meditative musical programs. We also translate into the melody the sequenced sections of genes, thereby producing Music of DNA.
This is a translation into the music of the genomic code Covid-19 type Delta.Each note in track is presented translation of the codon RNA gene Covid-19.Each track is sold separately and offers in a single copy NFT.You can become the only one in world collector of this album.
This is a translation into the music of the genomic code Covid-19 type Wuhan-Hu-1.Each note in track is presented translation of the codon RNA gene Covid-19 type Wuhan-Hu-1. The album contains 11 music tracks, 11 participants virus genes. You can become the only one in world collector of this album. — The uniqueness of the …
How does the assembly in the ribosome from the messenger mRNA of a gene region sound if translated into notes and sounded with various instruments. You are listening to the melody of the protein sequence assemblyFrom the human GENE AQP4Human AQP4 gene: identification of a locus encoding two polypeptide water channels in the brain.
Transfer to the melody of the amino acid assembly sequence of the basic myelin protein.A melody of translation (assembly) of amino acids (proteins) from the mRNA template region of the human MBP gene———————–
Transfer to the melody of the amino acid assembly sequence of the sequencing protein TSPO transcript.You are listening to the melody of the protein sequence assemblyFrom the human TSPO GENE Homo sapiens translocator protein (18kDa) (TSPO), transcript variant PBR-S, mRNA
Dna Music – How the Human GJB2 Gene Sings (translation mRNA)—————————–Translation into a melody from amino acid assembly sequences.The melody of the translation (assembly) of amino acids (proteins) from the mRNA template region of the human GJB2 gene—————————–Homo sapiens gap junction protein beta 2 (GJB2), mRNA/ gene = ”GJB2 ″/ Translation = “MDWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVW GDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEK KRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDG …
Transfer to the melody of the amino acid assembly sequence of the sequencing protein telomerase reverse transcriptase isoform 2 [Homo sapiens]
Translation on the assembly notes in the ribosome of proteins from the matrix mRNA of the Barley cultivar OWB-D (R gene), partial cds
Translation on the assembly notes in the ribosome of proteins from the matrix mRNA of the Indigofera cytisoides source https://www.ncbi.nlm.nih.gov/protein/AJP09288.1
